(data stored in ACNUC7421 zone)

EMBL: CR954246.NADE

CR954246.NADE        Location/Qualifiers
FT   CDS             complement(76850..77686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="PSHAa0075"
FT                   /product="NAD synthetase"
FT                   /function="2.5.11 : Pyridine nucleotides"
FT                   /EC_number="6.3.5.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8195100; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85184"
FT                   /db_xref="GOA:Q3IF87"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022926"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IF87"
FT                   /protein_id="CAI85184.1"
FT                   /translation="MRAEIMAAMKVQPVIDVNAEISRRVNFIKARLIAAHATSLVLGIS
FT                   GGVDSSVCGRLCQLAVNELNQEQSTTDYKFVAVRLPYGVQADENEAQLAVDFIQPSSRM
FT                   TVNIKPATDALHEQTMAAIVGNGESLPEQEKIDFIKGNVKARQRMIAQYEIAAFCQGLV
FT                   VGTDHSAENITGFYTKFGDGACDLAPLFGLSKRQVRALGSTLGASSVLVNKAPTADLES
FT                   DRPGLTDEEALGLSYEQIDDFLEGKPVTQQVEQTLSAIYQRTQHKRQPVPTIYDEL"
     MRAEIMAAMK VQPVIDVNAE ISRRVNFIKA RLIAAHATSL VLGISGGVDS SVCGRLCQLA        60
     VNELNQEQST TDYKFVAVRL PYGVQADENE AQLAVDFIQP SSRMTVNIKP ATDALHEQTM       120
     AAIVGNGESL PEQEKIDFIK GNVKARQRMI AQYEIAAFCQ GLVVGTDHSA ENITGFYTKF       180
     GDGACDLAPL FGLSKRQVRA LGSTLGASSV LVNKAPTADL ESDRPGLTDE EALGLSYEQI       240
     DDFLEGKPVT QQVEQTLSAI YQRTQHKRQP VPTIYDEL                               278
//

If you have problems or comments...

PBIL Back to PBIL home page