(data stored in ACNUC7421 zone)

EMBL: CR954246.NUDE

CR954246.NUDE        Location/Qualifiers
FT   CDS             135981..136592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudE"
FT                   /locus_tag="PSHAa0127"
FT                   /product="ADP compounds hydrolase nudE"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9452430, 11567017; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85231"
FT                   /db_xref="GOA:Q3IDG0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG0"
FT                   /protein_id="CAI85231.1"
FT                   /translation="MIKHNCHDSKLTPMTQKKHPIPPQILSNKVVAKSRLFTVESLELK
FT                   FSNNEERQYERIRGGGRGAVMIVPLTKDNELLLVREYCAGTNDYQLGFPKGLIDPGETP
FT                   EQAANRELKEEVGFGADYLKRLKAVSIAPSHFNTTMHIMVAKQLYSQTLPGDEPEPLVV
FT                   VKWPLTDWRSLLTQDDFTEARSVAALLLLDQYLASGVIDE"
     MIKHNCHDSK LTPMTQKKHP IPPQILSNKV VAKSRLFTVE SLELKFSNNE ERQYERIRGG        60
     GRGAVMIVPL TKDNELLLVR EYCAGTNDYQ LGFPKGLIDP GETPEQAANR ELKEEVGFGA       120
     DYLKRLKAVS IAPSHFNTTM HIMVAKQLYS QTLPGDEPEP LVVVKWPLTD WRSLLTQDDF       180
     TEARSVAALL LLDQYLASGV IDE                                               203
//

If you have problems or comments...

PBIL Back to PBIL home page