(data stored in ACNUC7421 zone)

EMBL: CR954246.OADA

CR954246.OADA        Location/Qualifiers
FT   CDS             552979..554760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadA"
FT                   /locus_tag="PSHAa0539"
FT                   /product="oxaloacetate decarboxylase, alpha subunit"
FT                   /function="1.2.4 : Cations"
FT                   /EC_number="4.1.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1331067; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85628"
FT                   /db_xref="GOA:Q3ILE6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR003379"
FT                   /db_xref="InterPro:IPR005776"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE6"
FT                   /protein_id="CAI85628.1"
FT                   /translation="MAKLKLTELVLRDAHQSLLATRMRLDDMLPIAKKLDDAGYWSIES
FT                   WGGATFDSCIRYLGEDPWERIRALKKAMPNTKQQMLLRGQNLLGYRHYADDVVEKFVER
FT                   AHKNGVDVFRIFDAMNDVRNLETAIKAAIKVGAHAQGTISYTVSPVHTLDMWLTLAKQL
FT                   EDLGCHSICIKDMAGLLKPYDAEKLIKALKETVSIPIAMQCHATTGLSTATYQKAIDAG
FT                   IDMLDTAISSMSMTYGHTATETIVSIVEGTERDTELDLNHLEEIAAYFRDVRKKYAAFE
FT                   GSLKGVDGRILLAQVPGGMLTNMENQLKEQGAADKLNEVLLEIPRVREDLGFLPLVTPT
FT                   SQIVGTQAVLNVLTGERYKTITKETAGVLKGEYGLTPAPMNKELQERVLDGAEVITCRP
FT                   ADNIAPELATLEAELLKEVQEQGLTLADEQIDDVLTYALFPQVGLKFIKNRNNPDAFEP
FT                   VPCVEDKSNKAPSKSASNNNSVKAEQYSVKVDGKVYDVVVAQGGELKEVTLKDSEHIPQ
FT                   SASVASGETLNAPLAGNIFKIKVKAGQVVNEGDVVIIMEAMKMETEIRATHTGTIAEVL
FT                   VGEGDAVTTGDAMIALA"
     MAKLKLTELV LRDAHQSLLA TRMRLDDMLP IAKKLDDAGY WSIESWGGAT FDSCIRYLGE        60
     DPWERIRALK KAMPNTKQQM LLRGQNLLGY RHYADDVVEK FVERAHKNGV DVFRIFDAMN       120
     DVRNLETAIK AAIKVGAHAQ GTISYTVSPV HTLDMWLTLA KQLEDLGCHS ICIKDMAGLL       180
     KPYDAEKLIK ALKETVSIPI AMQCHATTGL STATYQKAID AGIDMLDTAI SSMSMTYGHT       240
     ATETIVSIVE GTERDTELDL NHLEEIAAYF RDVRKKYAAF EGSLKGVDGR ILLAQVPGGM       300
     LTNMENQLKE QGAADKLNEV LLEIPRVRED LGFLPLVTPT SQIVGTQAVL NVLTGERYKT       360
     ITKETAGVLK GEYGLTPAPM NKELQERVLD GAEVITCRPA DNIAPELATL EAELLKEVQE       420
     QGLTLADEQI DDVLTYALFP QVGLKFIKNR NNPDAFEPVP CVEDKSNKAP SKSASNNNSV       480
     KAEQYSVKVD GKVYDVVVAQ GGELKEVTLK DSEHIPQSAS VASGETLNAP LAGNIFKIKV       540
     KAGQVVNEGD VVIIMEAMKM ETEIRATHTG TIAEVLVGEG DAVTTGDAMI ALA              593
//

If you have problems or comments...

PBIL Back to PBIL home page