(data stored in ACNUC7421 zone)

EMBL: CR954246.OADB

CR954246.OADB        Location/Qualifiers
FT   CDS             554774..555904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadB"
FT                   /locus_tag="PSHAa0540"
FT                   /product="Oxaloacetate decarboxylase, beta subunit"
FT                   /function="1.2.4 : Cations"
FT                   /EC_number="4.1.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2549031; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85629"
FT                   /db_xref="GOA:Q3ILE5"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILE5"
FT                   /protein_id="CAI85629.1"
FT                   /translation="MDGILNLWHATGIANFTFPALIMIAVGCLLLFLAIAKKFEPLLLL
FT                   PIGFGAILTNIPVAGLSDPGGLLHYVYYVGIDTGIFPLLIFMGVGALTDFSALIANPRM
FT                   LLLGAAAQFGIFATLFGAILLNYVPGFEFSLQDASAIAIIGGADGPTAIFLASKLAPDL
FT                   LGAIAVAAYSYMALVPIIQPPIMRALTTVEERQIKMPELRKVSKKEKIIFPLMVLSLTA
FT                   MFLPAAIPLVGMFCLGNLMRESGVVDRLSNSAQNEIINVTTIFLGLAVGSKLAADKFLT
FT                   VETIGILVLGALAFAIGTASGVFMAKGLNKISKTPINPLIGAAGVSAVPMAARVVNKVG
FT                   LESNPHNFLLMHAMGPNVAGVLGSAVAAGILLALVG"
     MDGILNLWHA TGIANFTFPA LIMIAVGCLL LFLAIAKKFE PLLLLPIGFG AILTNIPVAG        60
     LSDPGGLLHY VYYVGIDTGI FPLLIFMGVG ALTDFSALIA NPRMLLLGAA AQFGIFATLF       120
     GAILLNYVPG FEFSLQDASA IAIIGGADGP TAIFLASKLA PDLLGAIAVA AYSYMALVPI       180
     IQPPIMRALT TVEERQIKMP ELRKVSKKEK IIFPLMVLSL TAMFLPAAIP LVGMFCLGNL       240
     MRESGVVDRL SNSAQNEIIN VTTIFLGLAV GSKLAADKFL TVETIGILVL GALAFAIGTA       300
     SGVFMAKGLN KISKTPINPL IGAAGVSAVP MAARVVNKVG LESNPHNFLL MHAMGPNVAG       360
     VLGSAVAAGI LLALVG                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page