(data stored in ACNUC7421 zone)

EMBL: CR954246.ORN

CR954246.ORN         Location/Qualifiers
FT   CDS             505919..506464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="orn"
FT                   /locus_tag="PSHAa0488"
FT                   /product="oligoribonuclease"
FT                   /function="3.2.2.2 : Ribonucleases"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9573169; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0488"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85584"
FT                   /db_xref="GOA:Q3IG97"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IG97"
FT                   /protein_id="CAI85584.1"
FT                   /translation="MNINKSNLIWLDLEMTGLEPETDKILEIATVVTDADLNILAEGPT
FT                   IAIHQSNELLDNMDEWCTTQHGKSGLTARCKASTYDEAYAVEQTIAFLKQWVPAGASPM
FT                   CGNSIGQDRRFMNKYMRELEDFFHYRNLDVSTIKELARRWKPEVLAQVNKKGSHLALDD
FT                   IKDSIMELKVYREKFFNL"
     MNINKSNLIW LDLEMTGLEP ETDKILEIAT VVTDADLNIL AEGPTIAIHQ SNELLDNMDE        60
     WCTTQHGKSG LTARCKASTY DEAYAVEQTI AFLKQWVPAG ASPMCGNSIG QDRRFMNKYM       120
     RELEDFFHYR NLDVSTIKEL ARRWKPEVLA QVNKKGSHLA LDDIKDSIME LKVYREKFFN       180
     L                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page