(data stored in ACNUC7421 zone)

EMBL: CR954246.OSMY

CR954246.OSMY        Location/Qualifiers
FT   CDS             341380..341943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmY"
FT                   /locus_tag="PSHAa0325"
FT                   /product="putative hyperosmotically inducible periplasmic
FT                   protein"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85424"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILB2"
FT                   /protein_id="CAI85424.1"
FT                   /translation="MKTFNKSIIAALVLGTTAMGAQASSWENESKDAWIDGKAETVLLM
FT                   NTNLNNFDINTDVKNGKVILTGKVNSELDKELAEELVLSLDGVTDVDNQLTVVKNMNSK
FT                   SHDNMKDDDGSGLTDAKITTVITTRYLFNSEVGGTNIDVDTDNGVVTLTGTVNSDAEKQ
FT                   LAVKIAKNAEDVRDVVDKLTIVAK"
     MKTFNKSIIA ALVLGTTAMG AQASSWENES KDAWIDGKAE TVLLMNTNLN NFDINTDVKN        60
     GKVILTGKVN SELDKELAEE LVLSLDGVTD VDNQLTVVKN MNSKSHDNMK DDDGSGLTDA       120
     KITTVITTRY LFNSEVGGTN IDVDTDNGVV TLTGTVNSDA EKQLAVKIAK NAEDVRDVVD       180
     KLTIVAK                                                                 187
//

If you have problems or comments...

PBIL Back to PBIL home page