(data stored in ACNUC7421 zone)

EMBL: CR954246.PABA

CR954246.PABA        Location/Qualifiers
FT   CDS             203138..203719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="PSHAa0192"
FT                   /product="putative glutamine amidotransferase; putatively
FT                   involved in paraminobenzoate biosynthesis"
FT                   /function="2.5.2 : Folic acid"
FT                   /EC_number="4.1.3.27"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85295"
FT                   /db_xref="GOA:Q3IFU1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFU1"
FT                   /protein_id="CAI85295.1"
FT                   /translation="MLLMIDNYDSFTYNLVQYFQRLDQEVLVKRNDQITLSQIKQLNPQ
FT                   HIVISPGPKSPSEAGISLSIVEQLKGQYPILGICLGHQTIAQALGAKVVRAKKVMHGKT
FT                   SPIYHSDQGVFKGLAKPLTVCRYHSLIVEAQSLPKELQVTAWTQTQQGEFDEIMGLLHT
FT                   DLALEGVQFHPEAILTEQGLALLDNFLTRF"
     MLLMIDNYDS FTYNLVQYFQ RLDQEVLVKR NDQITLSQIK QLNPQHIVIS PGPKSPSEAG        60
     ISLSIVEQLK GQYPILGICL GHQTIAQALG AKVVRAKKVM HGKTSPIYHS DQGVFKGLAK       120
     PLTVCRYHSL IVEAQSLPKE LQVTAWTQTQ QGEFDEIMGL LHTDLALEGV QFHPEAILTE       180
     QGLALLDNFL TRF                                                          193
//

If you have problems or comments...

PBIL Back to PBIL home page