(data stored in ACNUC7421 zone)

EMBL: CR954246.PCK

CR954246.PCK         Location/Qualifiers
FT   CDS             complement(241543..243084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pck"
FT                   /locus_tag="PSHAa0228"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /EC_number="4.1.1.49"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85331"
FT                   /db_xref="GOA:Q3ILP3"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3ILP3"
FT                   /protein_id="CAI85331.1"
FT                   /translation="MTSSATRFVDLTAAELVEHAIRRGEGTLAANGAFVANTGHRTGRS
FT                   PKDRFIVQESSTENEIQWGNVNRPFDADKFDALWARVEAYVQSNDHFISHLEVGADPEH
FT                   YLPVVVTTETAWHHIFAKNMFIQPKSYNSSDVPQWQVMNVPSFVCEPERDGTNSDGTVL
FT                   INFAQRKVLLAGMRYAGEMKKSMFSVQNFLLPAKGVLPMHCSANVGEAGDTALFFGLSG
FT                   TGKTTLSADPTRFLIGDDEHGWAPGSVFNIEGGCYAKCIDLSQKNEPVIWDAIRFGTIL
FT                   ENVVLDENRVPDFNDTSLTQNSRAAYPLEHVEKRKVENRAGEPKAVVFLTCDVSGVLPP
FT                   VSILTEEAAAFHFLSGYTAKVGSTEIGSTSDIESTFSTCFGAPFFPRPAGVYAELLMKR
FT                   VREFGAKVYLVNTGWTGGPYGTGKRFDIPTTRAVVDAIVSGKLVGVETQHIDVLNLDVP
FT                   VAVPGVDSNLLNPINTWEDKAKYAEYAAKLAADFTENFTKYDVSDEIKNAGPKAQ"
     MTSSATRFVD LTAAELVEHA IRRGEGTLAA NGAFVANTGH RTGRSPKDRF IVQESSTENE        60
     IQWGNVNRPF DADKFDALWA RVEAYVQSND HFISHLEVGA DPEHYLPVVV TTETAWHHIF       120
     AKNMFIQPKS YNSSDVPQWQ VMNVPSFVCE PERDGTNSDG TVLINFAQRK VLLAGMRYAG       180
     EMKKSMFSVQ NFLLPAKGVL PMHCSANVGE AGDTALFFGL SGTGKTTLSA DPTRFLIGDD       240
     EHGWAPGSVF NIEGGCYAKC IDLSQKNEPV IWDAIRFGTI LENVVLDENR VPDFNDTSLT       300
     QNSRAAYPLE HVEKRKVENR AGEPKAVVFL TCDVSGVLPP VSILTEEAAA FHFLSGYTAK       360
     VGSTEIGSTS DIESTFSTCF GAPFFPRPAG VYAELLMKRV REFGAKVYLV NTGWTGGPYG       420
     TGKRFDIPTT RAVVDAIVSG KLVGVETQHI DVLNLDVPVA VPGVDSNLLN PINTWEDKAK       480
     YAEYAAKLAA DFTENFTKYD VSDEIKNAGP KAQ                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page