(data stored in ACNUC7421 zone)

EMBL: CR954246.PE102

CR954246.PE102       Location/Qualifiers
FT   CDS             110587..111492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0107"
FT                   /product="conserved protein of unknown function ; putative
FT                   membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0107"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85216"
FT                   /db_xref="GOA:Q3IDJ6"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ6"
FT                   /protein_id="CAI85216.1"
FT                   /translation="MAGTNLLTLLDDITVLLDDIATMSKVATKKTAGVLGDDLALNAQQ
FT                   VTGVAAERELPVVWAVAKGSFLNKAILVPAALLISVWLPWLITPLLMLGGLFLCFEGAE
FT                   KVFAKFLPHDDKSESEGDKLDLVEYEKQKVKGAIRTDFILSAEIIVITLGTVAAATLIN
FT                   QALVLCVIAIIMTIGVYGLVAGIVKLDDAGLYLLNQSKLSANKFKEILGKGLLAAAPRL
FT                   MQFLAFAGTVAMFLVGGGILVHGIKALHHIQIAVTNYGQTIVGTTGEVLAPLIFDGLLG
FT                   VIAGLVVVLGHLAYLKIFKK"
     MAGTNLLTLL DDITVLLDDI ATMSKVATKK TAGVLGDDLA LNAQQVTGVA AERELPVVWA        60
     VAKGSFLNKA ILVPAALLIS VWLPWLITPL LMLGGLFLCF EGAEKVFAKF LPHDDKSESE       120
     GDKLDLVEYE KQKVKGAIRT DFILSAEIIV ITLGTVAAAT LINQALVLCV IAIIMTIGVY       180
     GLVAGIVKLD DAGLYLLNQS KLSANKFKEI LGKGLLAAAP RLMQFLAFAG TVAMFLVGGG       240
     ILVHGIKALH HIQIAVTNYG QTIVGTTGEV LAPLIFDGLL GVIAGLVVVL GHLAYLKIFK       300
     K                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page