(data stored in ACNUC7421 zone)

EMBL: CR954246.PE103

CR954246.PE103       Location/Qualifiers
FT   CDS             complement(111581..113656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0108"
FT                   /product="putative TonB-dependent receptor; putative outer
FT                   membrane bound protein involved in iron chelated transport"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85217"
FT                   /db_xref="GOA:Q3IDJ5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ5"
FT                   /protein_id="CAI85217.1"
FT                   /translation="MKLSPLFIALLASTTASVYANATDIEHIEVKGSYFNDYKVDNANG
FT                   AMRTSASLLDTAQSVTVITDTIVNEQLATTLGEVLTNDASLTPGSKQRNREVFNLRGFE
FT                   LSSSTGYLRDGHQHWSHYQQPIEILQQVEVIKGPSSILYGQSGPGGLVNMVTKKPTSQT
FT                   LFKASADVDQHGSTRFMLDAGGALTESEDLRARGILVKQDVDYWREYQNGENRERDRFL
FT                   GALIVDYDISDNALVRVHYDRTDDEAGLDTGAWIDSNANVIGDDKTIRDMSWAFTDITV
FT                   ENLGVDLEVFLTENWQVKLGYNEQTFERQRFESAPRKPSNFIEGDSYASRPYDRFDDWQ
FT                   FKTAFVDFIGEFETFGIQHQFLIGANSLDYYYGQLKTNAESFDFSAGQNEPFRPAISYK
FT                   TDDTVSSSAYDYYGIYMQDLISFSPEWQLSLGGRYDKQSKENSNNESFVPKVGVLYHPN
FT                   ASATIYASYSEGFEPQNETLVNTNDVNNGMKLDAITSEQKEIGIKWQLFDDRLMLSGAL
FT                   FDISKTGTLVSEDLVNPVDNITSITTQAGEQRHKGFELAAQGAATDRLFVMASTMYLDA
FT                   NYERDATLQGKRPTDAPKWSASLWTRYELNDVIALNAGAFYEGERFADNANTVTKDAYT
FT                   RVDVGATYKINLNNTDVNLRLNIENLFDTNYLAGGGLNNVTIGEGASVRLAAQFSF"
     MKLSPLFIAL LASTTASVYA NATDIEHIEV KGSYFNDYKV DNANGAMRTS ASLLDTAQSV        60
     TVITDTIVNE QLATTLGEVL TNDASLTPGS KQRNREVFNL RGFELSSSTG YLRDGHQHWS       120
     HYQQPIEILQ QVEVIKGPSS ILYGQSGPGG LVNMVTKKPT SQTLFKASAD VDQHGSTRFM       180
     LDAGGALTES EDLRARGILV KQDVDYWREY QNGENRERDR FLGALIVDYD ISDNALVRVH       240
     YDRTDDEAGL DTGAWIDSNA NVIGDDKTIR DMSWAFTDIT VENLGVDLEV FLTENWQVKL       300
     GYNEQTFERQ RFESAPRKPS NFIEGDSYAS RPYDRFDDWQ FKTAFVDFIG EFETFGIQHQ       360
     FLIGANSLDY YYGQLKTNAE SFDFSAGQNE PFRPAISYKT DDTVSSSAYD YYGIYMQDLI       420
     SFSPEWQLSL GGRYDKQSKE NSNNESFVPK VGVLYHPNAS ATIYASYSEG FEPQNETLVN       480
     TNDVNNGMKL DAITSEQKEI GIKWQLFDDR LMLSGALFDI SKTGTLVSED LVNPVDNITS       540
     ITTQAGEQRH KGFELAAQGA ATDRLFVMAS TMYLDANYER DATLQGKRPT DAPKWSASLW       600
     TRYELNDVIA LNAGAFYEGE RFADNANTVT KDAYTRVDVG ATYKINLNNT DVNLRLNIEN       660
     LFDTNYLAGG GLNNVTIGEG ASVRLAAQFS F                                      691
//

If you have problems or comments...

PBIL Back to PBIL home page