(data stored in ACNUC7421 zone)

EMBL: CR954246.PE105

CR954246.PE105       Location/Qualifiers
FT   CDS             complement(115260..115787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0110"
FT                   /product="putative DnaJ-class molecular chaperone"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type mc : molecular chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85219"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR021059"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ3"
FT                   /protein_id="CAI85219.1"
FT                   /translation="MVHTLAAELQQRKMINTLDVAPDRDLFKRNFLIMNALYQLQQQIM
FT                   PKQQLLISGLQIQLITTASNTLIKNTDPLRDYYLDWQNFETSSAEIDTLLTQFWQRFTK
FT                   HSKSAQIIDLDTHKQLLIKWQLSQQSTLKEVQKRWRQLALQCHPDKAVGNAEKFKQLKG
FT                   EYEQLRASCSVD"
     MVHTLAAELQ QRKMINTLDV APDRDLFKRN FLIMNALYQL QQQIMPKQQL LISGLQIQLI        60
     TTASNTLIKN TDPLRDYYLD WQNFETSSAE IDTLLTQFWQ RFTKHSKSAQ IIDLDTHKQL       120
     LIKWQLSQQS TLKEVQKRWR QLALQCHPDK AVGNAEKFKQ LKGEYEQLRA SCSVD            175
//

If you have problems or comments...

PBIL Back to PBIL home page