(data stored in ACNUC7421 zone)

EMBL: CR954246.PE106

CR954246.PE106       Location/Qualifiers
FT   CDS             115918..118746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0111"
FT                   /product="putative membrane bound sensor or esterase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85220"
FT                   /db_xref="GOA:Q3IDJ2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDJ2"
FT                   /protein_id="CAI85220.1"
FT                   /translation="MQGWLQRFFFVGFMAVCSIFSTLSFSVTPADLFEQFKSAESWSDK
FT                   QSFASTLLTKKNLPHQQRIAIYSDLAELAFNANDLPHALEYYKLLESSITFNELPDLYF
FT                   RAIKMQGVVLYYQGFVQQAVVDYSRALGLAIRLKGSLKQANLLSNIGLAYFDMYNMELA
FT                   LDYYQQAKLIYEKEGSAQDKADILHNIAGIYIRLSRYESALEMYREVLKVFQQLGDEDG
FT                   VAQVYGNMGVAYTESKQYQLALHYNQLALRYYQSINNAFQLSTKHANLASINLHLNKFD
FT                   VALYHAKAAQQFALDAGNKSLLAAALHVLATAQFAQGDIENAKTTSEHSIALAKEYKNG
FT                   MRIKDGLGIEALIYSSLGDFKQALQLHQQYVDYQRSINTEEASKAVSIFQTQFEADKLN
FT                   QEIKQLKQQQHLQQLEISKRSQLTILLGIVAILILITVIAIYRRRIESNAKLQLTEQVE
FT                   QRTLELQSVAQELREANDVKSQFLANISHEIRTPLTAILSQTDDLINGLYDPEQLQDEL
FT                   KVIQRQSEHLKSLINDVLDLSKIEANRLELSISCFDIVQVLNDIHGMFSVQAKAKNLSL
FT                   VFDNQLGDELYTRLDLTRVKQILINLCANAIKFTHSGQVTIVANNTEQGLVLTVKDTGI
FT                   GMNTAQLKLIFECFSQADNSISRRFGGTGLGLSLSQQLAAMMGGYISVQSEFKKGSQFS
FT                   FFVPCVPVDKSECAVTAKDNINGDYKALSAKVLLAEDHDDNRRLISRYLRAMGLDVIAV
FT                   ENGEQAVEQCLKEYPDFVLLDIQMPIMDGITAFELLRQCGYEQPIFALTANAMSHEIEQ
FT                   YLALGFTDYLAKPIDKEKFYSTIAEHLASIKNEQNSTSVNIDMSDLVTSFKQSLSIESE
FT                   LISQHFNSGDFVALQKDSHRILGAAQMFKLCDIADAAKALDDACKSPEEVQNIAVLVDK
FT                   LQALFLHYKEHG"
     MQGWLQRFFF VGFMAVCSIF STLSFSVTPA DLFEQFKSAE SWSDKQSFAS TLLTKKNLPH        60
     QQRIAIYSDL AELAFNANDL PHALEYYKLL ESSITFNELP DLYFRAIKMQ GVVLYYQGFV       120
     QQAVVDYSRA LGLAIRLKGS LKQANLLSNI GLAYFDMYNM ELALDYYQQA KLIYEKEGSA       180
     QDKADILHNI AGIYIRLSRY ESALEMYREV LKVFQQLGDE DGVAQVYGNM GVAYTESKQY       240
     QLALHYNQLA LRYYQSINNA FQLSTKHANL ASINLHLNKF DVALYHAKAA QQFALDAGNK       300
     SLLAAALHVL ATAQFAQGDI ENAKTTSEHS IALAKEYKNG MRIKDGLGIE ALIYSSLGDF       360
     KQALQLHQQY VDYQRSINTE EASKAVSIFQ TQFEADKLNQ EIKQLKQQQH LQQLEISKRS       420
     QLTILLGIVA ILILITVIAI YRRRIESNAK LQLTEQVEQR TLELQSVAQE LREANDVKSQ       480
     FLANISHEIR TPLTAILSQT DDLINGLYDP EQLQDELKVI QRQSEHLKSL INDVLDLSKI       540
     EANRLELSIS CFDIVQVLND IHGMFSVQAK AKNLSLVFDN QLGDELYTRL DLTRVKQILI       600
     NLCANAIKFT HSGQVTIVAN NTEQGLVLTV KDTGIGMNTA QLKLIFECFS QADNSISRRF       660
     GGTGLGLSLS QQLAAMMGGY ISVQSEFKKG SQFSFFVPCV PVDKSECAVT AKDNINGDYK       720
     ALSAKVLLAE DHDDNRRLIS RYLRAMGLDV IAVENGEQAV EQCLKEYPDF VLLDIQMPIM       780
     DGITAFELLR QCGYEQPIFA LTANAMSHEI EQYLALGFTD YLAKPIDKEK FYSTIAEHLA       840
     SIKNEQNSTS VNIDMSDLVT SFKQSLSIES ELISQHFNSG DFVALQKDSH RILGAAQMFK       900
     LCDIADAAKA LDDACKSPEE VQNIAVLVDK LQALFLHYKE HG                          942
//

If you have problems or comments...

PBIL Back to PBIL home page