(data stored in ACNUC7421 zone)

EMBL: CR954246.PE111

CR954246.PE111       Location/Qualifiers
FT   CDS             complement(129336..131405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0121"
FT                   /product="conserved protein of unknown function ; putative
FT                   acetyltransferase domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85225"
FT                   /db_xref="GOA:Q3IDD4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR013562"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDD4"
FT                   /protein_id="CAI85225.1"
FT                   /translation="MQDYKLYKKQLIQLEQQLAGAHHRQLVLVTGNDNWCYELTNSLVQ
FT                   NTNTLTLSKHCALKNAQWPAHIHQILGQEFTHAIYDGFSGLYPDKLAAIAGTVRAGGVL
FT                   FVLLPELGNLNNWQDPALKSVQSHGHSNQYSLFNQRFSSIIKSLPALHYSEEFGCINNN
FT                   YNYVLHSNIDFEPQKNCVAQIVKVAHGRANRPLLINADRGRGKSAALGLAAAKLADKNV
FT                   IICATQFRATHSSFKHLAAQLNVNYDPLQKQLANMQYIAPDALLNELPECDVLLVDEAA
FT                   AIPVPMLLSMLAHYPRIVFASTLVGYEGNGRGYTIRFSQYIKNHYKASKVITLDEPLRF
FT                   AKHDPLEQHIRSLLALDAQYQETNSNKSQIPKHSEVTQQQLVTDEALLCQVVALLALAH
FT                   YQSSVNDLRQLLDAPSQRIFISKIDKQLVGVCLIAIEGGLSEELTEQVISGERRPQGHL
FT                   MAQTLAQLSFNSDFLTHLSARVVRIAIDPSSHNCGLGKALLSYSESQVKEQCTWFGASF
FT                   GATAQLLKFWQSLGFNAVKLGYQRDKSTAEHATLVVKSLNAPQQSLQSLIKQFQYELFY
FT                   GLLSHFKSLEWQLVSTLLRSFNDEVIASDTLRLFTQQLSSNRFTISPTLWRLISQSPAA
FT                   MTKLASNQQQLLIQTVLQHHTDEQLIKNLNLNGKKQLEQQFRNTTNILAKQLSS"
     MQDYKLYKKQ LIQLEQQLAG AHHRQLVLVT GNDNWCYELT NSLVQNTNTL TLSKHCALKN        60
     AQWPAHIHQI LGQEFTHAIY DGFSGLYPDK LAAIAGTVRA GGVLFVLLPE LGNLNNWQDP       120
     ALKSVQSHGH SNQYSLFNQR FSSIIKSLPA LHYSEEFGCI NNNYNYVLHS NIDFEPQKNC       180
     VAQIVKVAHG RANRPLLINA DRGRGKSAAL GLAAAKLADK NVIICATQFR ATHSSFKHLA       240
     AQLNVNYDPL QKQLANMQYI APDALLNELP ECDVLLVDEA AAIPVPMLLS MLAHYPRIVF       300
     ASTLVGYEGN GRGYTIRFSQ YIKNHYKASK VITLDEPLRF AKHDPLEQHI RSLLALDAQY       360
     QETNSNKSQI PKHSEVTQQQ LVTDEALLCQ VVALLALAHY QSSVNDLRQL LDAPSQRIFI       420
     SKIDKQLVGV CLIAIEGGLS EELTEQVISG ERRPQGHLMA QTLAQLSFNS DFLTHLSARV       480
     VRIAIDPSSH NCGLGKALLS YSESQVKEQC TWFGASFGAT AQLLKFWQSL GFNAVKLGYQ       540
     RDKSTAEHAT LVVKSLNAPQ QSLQSLIKQF QYELFYGLLS HFKSLEWQLV STLLRSFNDE       600
     VIASDTLRLF TQQLSSNRFT ISPTLWRLIS QSPAAMTKLA SNQQQLLIQT VLQHHTDEQL       660
     IKNLNLNGKK QLEQQFRNTT NILAKQLSS                                         689
//

If you have problems or comments...

PBIL Back to PBIL home page