(data stored in ACNUC7421 zone)

EMBL: CR954246.PE114

CR954246.PE114       Location/Qualifiers
FT   CDS             134118..134564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0124"
FT                   /product="conserved protein of unknown function (similar to
FT                   E. coli YacL)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0124"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85228"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG3"
FT                   /protein_id="CAI85228.1"
FT                   /translation="MALFCFLASAAIYVYNCATNDLKAIRMEYQFIRDPISGLRIKISS
FT                   EHAIIGRWLNEEIGKDKIAMVQALIASVSSSFEPLTLKGQEIDLILTKDEALFEAHALH
FT                   QDSEDLMAYQDDDLMLEENGLSSGCGFEDFIDLINSWHEFTTSR"
     MALFCFLASA AIYVYNCATN DLKAIRMEYQ FIRDPISGLR IKISSEHAII GRWLNEEIGK        60
     DKIAMVQALI ASVSSSFEPL TLKGQEIDLI LTKDEALFEA HALHQDSEDL MAYQDDDLML       120
     EENGLSSGCG FEDFIDLINS WHEFTTSR                                          148
//

If you have problems or comments...

PBIL Back to PBIL home page