(data stored in ACNUC7421 zone)

EMBL: CR954246.PE115

CR954246.PE115       Location/Qualifiers
FT   CDS             134671..135294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0125"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85229"
FT                   /db_xref="InterPro:IPR014871"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG2"
FT                   /protein_id="CAI85229.1"
FT                   /translation="MSANLNKLVVMLEMQNAMNTKVHDQWFSQGFDWYRAIWVECAEML
FT                   DHYGWKWWKKQTPDTEQVILELVDIFHFGLSLRIDGITSYEKIAKQLELELSTAHQADD
FT                   FKQTLEVLAASAVADKTFNAAAFAGCMAQIGMNIDDLYRGYVGKNTLNFFRQDHGYKDG
FT                   SYIKVWGGQEDNEHLVEVVKSLNTEHADFAKLVYEGLEARYPTK"
     MSANLNKLVV MLEMQNAMNT KVHDQWFSQG FDWYRAIWVE CAEMLDHYGW KWWKKQTPDT        60
     EQVILELVDI FHFGLSLRID GITSYEKIAK QLELELSTAH QADDFKQTLE VLAASAVADK       120
     TFNAAAFAGC MAQIGMNIDD LYRGYVGKNT LNFFRQDHGY KDGSYIKVWG GQEDNEHLVE       180
     VVKSLNTEHA DFAKLVYEGL EARYPTK                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page