(data stored in ACNUC7421 zone)

EMBL: CR954246.PE116

CR954246.PE116       Location/Qualifiers
FT   CDS             complement(135310..135957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0126"
FT                   /product="putative hydrolase, contains a phosphatase-like
FT                   domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85230"
FT                   /db_xref="GOA:Q3IDG1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDG1"
FT                   /protein_id="CAI85230.1"
FT                   /translation="MLNWSKIDTVLLDMDGTLLDLHYDSHFWLNVIPQQHALAKNISFE
FT                   AAQADISKRYQAVSGKIQWYCSDYWEQQLNLPIMELKRQSKHLIKVRDDVPYFLTELKK
FT                   AGKELILLTNAHPECVMLKFEQTAIDNYLDGVVSTHEYGVSKEQQSLWQQVQSDLGFNK
FT                   SRTLFVDDSVPVLNAARQYGIEHLLAVANPDSQQPHNDIADYLNVTDYRKLI"
     MLNWSKIDTV LLDMDGTLLD LHYDSHFWLN VIPQQHALAK NISFEAAQAD ISKRYQAVSG        60
     KIQWYCSDYW EQQLNLPIME LKRQSKHLIK VRDDVPYFLT ELKKAGKELI LLTNAHPECV       120
     MLKFEQTAID NYLDGVVSTH EYGVSKEQQS LWQQVQSDLG FNKSRTLFVD DSVPVLNAAR       180
     QYGIEHLLAV ANPDSQQPHN DIADYLNVTD YRKLI                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page