(data stored in ACNUC7421 zone)

EMBL: CR954246.PE118

CR954246.PE118       Location/Qualifiers
FT   CDS             136585..137370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0128"
FT                   /product="carbohydrate phosphatase; putative CysQ protein
FT                   duplicate"
FT                   /function="2.1.3.1 : Carbohydrates (other than glucose)"
FT                   /function="2.7 : Metabolism of phosphate"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85232"
FT                   /db_xref="GOA:Q3IDF9"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006240"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF9"
FT                   /protein_id="CAI85232.1"
FT                   /translation="MNKLLEPCILLAERAGDAIMAIYKNGDIGKEQKLDNTPVTKADLA
FT                   ANDVLVAGLEALAPNIPIMSEETPIPALADRQHWQRYWLLDPMDGTGEFILESGDFAVN
FT                   IALIENNQPVLGVIHWPTKGVTYFASADNGAFKRKNGSDKQIFVASPDNLTVAVSRRQK
FT                   IEAVSQYLNAQFTTVALGSCSLKACIVAEGKADCFLRIGPTGEWDTGASQIIVEQAGGS
FT                   ITDAEFNPLTYNQRESTENPDFIVMGHPDWEWQKMINPH"
     MNKLLEPCIL LAERAGDAIM AIYKNGDIGK EQKLDNTPVT KADLAANDVL VAGLEALAPN        60
     IPIMSEETPI PALADRQHWQ RYWLLDPMDG TGEFILESGD FAVNIALIEN NQPVLGVIHW       120
     PTKGVTYFAS ADNGAFKRKN GSDKQIFVAS PDNLTVAVSR RQKIEAVSQY LNAQFTTVAL       180
     GSCSLKACIV AEGKADCFLR IGPTGEWDTG ASQIIVEQAG GSITDAEFNP LTYNQRESTE       240
     NPDFIVMGHP DWEWQKMINP H                                                 261
//

If you have problems or comments...

PBIL Back to PBIL home page