(data stored in ACNUC7421 zone)

EMBL: CR954246.PE119

CR954246.PE119       Location/Qualifiers
FT   CDS             138548..139162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0129"
FT                   /product="putative membrane protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85233"
FT                   /db_xref="GOA:Q3IDF7"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF7"
FT                   /protein_id="CAI85233.1"
FT                   /translation="MTELYHWFDLIGVAVFAISGTLVAYEKKMDGFGVVVLATVTAIGG
FT                   GTVRDVILNVPVFWLHDQSYFAAILAAILLTTRLINKQRTIPHYNLQIADAFGLAFFAV
FT                   MGTQKALLAGMPDMTAVIMGVITGCFGGLIRDVLAREIPMLLKGELYATTCIAGGIVYT
FT                   LCINFSLIVEVAMILSMLMTLLLRFAAIKWGIVLHVFKYPD"
     MTELYHWFDL IGVAVFAISG TLVAYEKKMD GFGVVVLATV TAIGGGTVRD VILNVPVFWL        60
     HDQSYFAAIL AAILLTTRLI NKQRTIPHYN LQIADAFGLA FFAVMGTQKA LLAGMPDMTA       120
     VIMGVITGCF GGLIRDVLAR EIPMLLKGEL YATTCIAGGI VYTLCINFSL IVEVAMILSM       180
     LMTLLLRFAA IKWGIVLHVF KYPD                                              204
//

If you have problems or comments...

PBIL Back to PBIL home page