(data stored in ACNUC7421 zone)

EMBL: CR954246.PE121

CR954246.PE121       Location/Qualifiers
FT   CDS             complement(140704..141423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0131"
FT                   /product="putative response regulator in two-component
FT                   regulatory system"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85235"
FT                   /db_xref="GOA:Q3IDF5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF5"
FT                   /protein_id="CAI85235.1"
FT                   /translation="MTIHVLLVEDDELLVKRIQNHFTNTEFTIEVDPTGADALSTIRSR
FT                   VNLRGAFSLAIIDIVLPKRDGLQLAKELNTLTDIGVILLSSRDSQADRIAGLAQGADDY
FT                   ICKPVDLLELELRMRALYKRIAHLNSDNDKNDDNGEEFIEYADFKLHPDNRTLITATGA
FT                   ESRLTEAEHKVLICLIGNAGKATSREKISEEIGQPDWSPNDRTVDVLIGRLRKKLNDEK
FT                   DQKRIVTVRGKGYMLSI"
     MTIHVLLVED DELLVKRIQN HFTNTEFTIE VDPTGADALS TIRSRVNLRG AFSLAIIDIV        60
     LPKRDGLQLA KELNTLTDIG VILLSSRDSQ ADRIAGLAQG ADDYICKPVD LLELELRMRA       120
     LYKRIAHLNS DNDKNDDNGE EFIEYADFKL HPDNRTLITA TGAESRLTEA EHKVLICLIG       180
     NAGKATSREK ISEEIGQPDW SPNDRTVDVL IGRLRKKLND EKDQKRIVTV RGKGYMLSI        239
//

If you have problems or comments...

PBIL Back to PBIL home page