(data stored in ACNUC7421 zone)

EMBL: CR954246.PE122

CR954246.PE122       Location/Qualifiers
FT   CDS             complement(141653..144154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0132"
FT                   /product="putative secreted hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /EC_number="3.4.19.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85236"
FT                   /db_xref="GOA:Q3IDF4"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF4"
FT                   /protein_id="CAI85236.1"
FT                   /translation="MKLNALWRHSNKLFKHSFALFTLSSLSFAAFAAPLDKSKIQFIGP
FT                   LAENMQLKPFQTAQSDSIISNLLPQLQLPVANFSVFDKKHSWQPFNKINALTLGGLQAL
FT                   KFNIETTRFSQGTLTLKGIEQGQLFINGELQKADNSSYKLALNNGSHTAIIVAQQVANW
FT                   HDVILDFAPKTPSDNITLSTSQTKRLSAKQLFDAPTISGLSLAPNSEHYITTTRRFNDK
FT                   TLNQANNVTELKNTDNQTLYRFEAEQPSNLIWSPDNRFLVYLLNGELKQLNRKNLSIKT
FT                   LSTRLEGASGFTFYNEHSVIFSWSNPASDKGNDKLTKHYKGLQDRWSYARSVSQVYMLD
FT                   TQSGLIKTLSQGPLSHSFEDFNNKRGKLLMSRPVVAMQASTHPETELVELDLKSNKLTS
FT                   LGKFKTFNQAKYANKDVYVVAGPDFKNGAGRALPKEMLANNYDGQLYLLTDGGKNVKAL
FT                   SKQFDPAIGRLSVLNNGDALLKVTEHDTQPLYLFDLSKQRFKKLNTGLDIVEQFSYSNE
FT                   RNIEILLSGTTASSPQQLKRFNISKNTAKIVWDSKPLSYANTYIPTLEEFNFTNKNGVE
FT                   ISGRVYIPNNLDKTKKHPALVYYYGGTSPVTRGFTGRYPFNLWAANGYVVYVIQPTGAT
FT                   GFGQKFSAQHVNAWGNYTSDDIIAGTQAFLNKYNYVDSKKVGNLGASYGGFMTMHLATK
FT                   TDLFSASISHAGISNLTSYWGEGWWGYLYSGEASKNSFPWNNPELYSKHSPVFYADKVT
FT                   TPMLLIHGDSDTNVPVGESLTMYTALKLLNKDVELIEYKGANHQIIARDQRFDWWNTML
FT                   AYFDKKLKNEPQWWDYLYPND"
     MKLNALWRHS NKLFKHSFAL FTLSSLSFAA FAAPLDKSKI QFIGPLAENM QLKPFQTAQS        60
     DSIISNLLPQ LQLPVANFSV FDKKHSWQPF NKINALTLGG LQALKFNIET TRFSQGTLTL       120
     KGIEQGQLFI NGELQKADNS SYKLALNNGS HTAIIVAQQV ANWHDVILDF APKTPSDNIT       180
     LSTSQTKRLS AKQLFDAPTI SGLSLAPNSE HYITTTRRFN DKTLNQANNV TELKNTDNQT       240
     LYRFEAEQPS NLIWSPDNRF LVYLLNGELK QLNRKNLSIK TLSTRLEGAS GFTFYNEHSV       300
     IFSWSNPASD KGNDKLTKHY KGLQDRWSYA RSVSQVYMLD TQSGLIKTLS QGPLSHSFED       360
     FNNKRGKLLM SRPVVAMQAS THPETELVEL DLKSNKLTSL GKFKTFNQAK YANKDVYVVA       420
     GPDFKNGAGR ALPKEMLANN YDGQLYLLTD GGKNVKALSK QFDPAIGRLS VLNNGDALLK       480
     VTEHDTQPLY LFDLSKQRFK KLNTGLDIVE QFSYSNERNI EILLSGTTAS SPQQLKRFNI       540
     SKNTAKIVWD SKPLSYANTY IPTLEEFNFT NKNGVEISGR VYIPNNLDKT KKHPALVYYY       600
     GGTSPVTRGF TGRYPFNLWA ANGYVVYVIQ PTGATGFGQK FSAQHVNAWG NYTSDDIIAG       660
     TQAFLNKYNY VDSKKVGNLG ASYGGFMTMH LATKTDLFSA SISHAGISNL TSYWGEGWWG       720
     YLYSGEASKN SFPWNNPELY SKHSPVFYAD KVTTPMLLIH GDSDTNVPVG ESLTMYTALK       780
     LLNKDVELIE YKGANHQIIA RDQRFDWWNT MLAYFDKKLK NEPQWWDYLY PND              833
//

If you have problems or comments...

PBIL Back to PBIL home page