(data stored in ACNUC7421 zone)

EMBL: CR954246.PE123

CR954246.PE123       Location/Qualifiers
FT   CDS             144239..145315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0133"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85237"
FT                   /db_xref="GOA:Q3IDF3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF3"
FT                   /protein_id="CAI85237.1"
FT                   /translation="MTLLIVYMVVAIVISFLCSVMEAVLLSISPSYVALLRKKQPVLAK
FT                   QLEKLKNNIDQPLAAILTLNTVAHTAGAAGVGAQAAIVFSDAAVGVASAVMTLFVLVFS
FT                   EIIPKTLGANYWRVLTPSVTYGLRFLVILLKPFVWLAQKLTNLMGPKHDQAYYIRQEIE
FT                   AMADIGTESGALHQDESEIIRNLLHFRHAKLCDLMTPRTVIFKVHKDLTVNEYLNLHGS
FT                   SSFSRILVFDKDTDDIIGFVHKNDIMLACHRLGSDYKISKLVKPIYTVPSSQNASSLLQ
FT                   TLLTDRTHICLVVDEYGDVQGIVTLEDMIEALMGLEIVDERDQSTNMRAVAKQRWHKRL
FT                   ANSKNLVTEEDKHPRGDN"
     MTLLIVYMVV AIVISFLCSV MEAVLLSISP SYVALLRKKQ PVLAKQLEKL KNNIDQPLAA        60
     ILTLNTVAHT AGAAGVGAQA AIVFSDAAVG VASAVMTLFV LVFSEIIPKT LGANYWRVLT       120
     PSVTYGLRFL VILLKPFVWL AQKLTNLMGP KHDQAYYIRQ EIEAMADIGT ESGALHQDES       180
     EIIRNLLHFR HAKLCDLMTP RTVIFKVHKD LTVNEYLNLH GSSSFSRILV FDKDTDDIIG       240
     FVHKNDIMLA CHRLGSDYKI SKLVKPIYTV PSSQNASSLL QTLLTDRTHI CLVVDEYGDV       300
     QGIVTLEDMI EALMGLEIVD ERDQSTNMRA VAKQRWHKRL ANSKNLVTEE DKHPRGDN         358
//

If you have problems or comments...

PBIL Back to PBIL home page