(data stored in ACNUC7421 zone)

EMBL: CR954246.PE124

CR954246.PE124       Location/Qualifiers
FT   CDS             complement(145329..146612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0134"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85238"
FT                   /db_xref="GOA:Q3IDF2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF2"
FT                   /protein_id="CAI85238.1"
FT                   /translation="MRIYYFYSNTHYALKGITVKKVVPNILVVDDSKAILIVMEAILAE
FT                   LDMSETITTCLSATKALEKVKRDINYFDAIFTDLNMPEMDGMELIRHLGELNYQGAIII
FT                   ISEMEHKVISLAANLAKQHNAHLIGNISKPVQLTQVGSLLNKVAYLNSHTLIKEPAISK
FT                   TELINALKNDEITPFYQPKICINTSKIKSAEVLARIVSNTDGSIILPARFISLAEQHDL
FT                   INEITFALFEKATSDFENIKEQLGQNLKLAFNLSPMQLNDLSCPNKLLLILKLNQLKPS
FT                   DIIIEITEQHALSSLSQLETLNRLRMHGFGLSLDDFGVGFTNMSQLKNLPFTEIKIDRT
FT                   LISNIETDQFSQVVVSSLIDITNQEHLELVAEGVERPEELAYLRHYKTRLAIQGFLFSR
FT                   PKSKSEFIDWAQYWIKVTGNTINYKPPS"
     MRIYYFYSNT HYALKGITVK KVVPNILVVD DSKAILIVME AILAELDMSE TITTCLSATK        60
     ALEKVKRDIN YFDAIFTDLN MPEMDGMELI RHLGELNYQG AIIIISEMEH KVISLAANLA       120
     KQHNAHLIGN ISKPVQLTQV GSLLNKVAYL NSHTLIKEPA ISKTELINAL KNDEITPFYQ       180
     PKICINTSKI KSAEVLARIV SNTDGSIILP ARFISLAEQH DLINEITFAL FEKATSDFEN       240
     IKEQLGQNLK LAFNLSPMQL NDLSCPNKLL LILKLNQLKP SDIIIEITEQ HALSSLSQLE       300
     TLNRLRMHGF GLSLDDFGVG FTNMSQLKNL PFTEIKIDRT LISNIETDQF SQVVVSSLID       360
     ITNQEHLELV AEGVERPEEL AYLRHYKTRL AIQGFLFSRP KSKSEFIDWA QYWIKVTGNT       420
     INYKPPS                                                                 427
//

If you have problems or comments...

PBIL Back to PBIL home page