(data stored in ACNUC7421 zone)

EMBL: CR954246.PE125

CR954246.PE125       Location/Qualifiers
FT   CDS             146735..147751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0135"
FT                   /product="putative metalloprotease; probable metal binding
FT                   site"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85239"
FT                   /db_xref="GOA:Q3IDF1"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDF1"
FT                   /protein_id="CAI85239.1"
FT                   /translation="MIRIELKLADQPFTLMVSGQKVVQIFHSQQAITFDNPRDNYYQFT
FT                   FDNKLIGIDSSLVNEQSISLFVNDEFATQLALPAATGGETKKGWLGLAALGFKLFKSAK
FT                   VIKVVLAGASVAGYAWLFSIEFALMLIACLVVHEYGHVRAMQYFGIKTKGIYLIPFVGG
FT                   LAVSDDKITTRWQDVVISLMGPAFGLITSVLSLVLYYATEMEIFAGVAVLSALLNLFNL
FT                   LPILPLDGGHVLKSISFSMRSWVGLSVCLLGVLFGLWLSYTFGLMLLVFFLFIGALEIV
FT                   FEWRGRHTSHLMPLDKYGQGFSAVMYALVVAGHIAVMMHFADSENPILSLPMKILSS"
     MIRIELKLAD QPFTLMVSGQ KVVQIFHSQQ AITFDNPRDN YYQFTFDNKL IGIDSSLVNE        60
     QSISLFVNDE FATQLALPAA TGGETKKGWL GLAALGFKLF KSAKVIKVVL AGASVAGYAW       120
     LFSIEFALML IACLVVHEYG HVRAMQYFGI KTKGIYLIPF VGGLAVSDDK ITTRWQDVVI       180
     SLMGPAFGLI TSVLSLVLYY ATEMEIFAGV AVLSALLNLF NLLPILPLDG GHVLKSISFS       240
     MRSWVGLSVC LLGVLFGLWL SYTFGLMLLV FFLFIGALEI VFEWRGRHTS HLMPLDKYGQ       300
     GFSAVMYALV VAGHIAVMMH FADSENPILS LPMKILSS                               338
//

If you have problems or comments...

PBIL Back to PBIL home page