(data stored in ACNUC7421 zone)

EMBL: CR954246.PE127

CR954246.PE127       Location/Qualifiers
FT   CDS             149300..150370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0137"
FT                   /product="putative potassium channel"
FT                   /function="1.2.4 : Cations"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85241"
FT                   /db_xref="GOA:Q3IF32"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF32"
FT                   /protein_id="CAI85241.1"
FT                   /translation="MPVIFKRLVLLVRAHIDQLSWQAVALAILTHMLLTWGLLYIANEQ
FT                   ALTSLTTFFYYYTVTTSTVGYGDFSPTTDLGRWVVALIQIPFGLALFGVLLGKTGQTIT
FT                   YLIRRAMTGDKNFAHSSNHIIIFGWHDTRTKKMIDYILADTKRTERRILLAVTEQMEHP
FT                   FLSNESVDFVRLSSFTDLEELKRVAISYADKVIIDGQDDDQTFTTALRISRLVKDDCHI
FT                   SAHFLDETKVDMLLEHCQNVECSSVKSAEILVRSMQDPGSSRVHEELLSILHGDTQFSL
FT                   AIPEQSKEMEFGTLFHHFKHQHDAILLGVAHNLSAQNMDLNPPLDYKINAGDILHYIAV
FT                   ERVLSREVDWPALAKA"
     MPVIFKRLVL LVRAHIDQLS WQAVALAILT HMLLTWGLLY IANEQALTSL TTFFYYYTVT        60
     TSTVGYGDFS PTTDLGRWVV ALIQIPFGLA LFGVLLGKTG QTITYLIRRA MTGDKNFAHS       120
     SNHIIIFGWH DTRTKKMIDY ILADTKRTER RILLAVTEQM EHPFLSNESV DFVRLSSFTD       180
     LEELKRVAIS YADKVIIDGQ DDDQTFTTAL RISRLVKDDC HISAHFLDET KVDMLLEHCQ       240
     NVECSSVKSA EILVRSMQDP GSSRVHEELL SILHGDTQFS LAIPEQSKEM EFGTLFHHFK       300
     HQHDAILLGV AHNLSAQNMD LNPPLDYKIN AGDILHYIAV ERVLSREVDW PALAKA           356
//

If you have problems or comments...

PBIL Back to PBIL home page