(data stored in ACNUC7421 zone)

EMBL: CR954246.PE129

CR954246.PE129       Location/Qualifiers
FT   CDS             complement(150651..151682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0139"
FT                   /product="conserved protein of unknown function; similar to
FT                   a protein from a plasmid"
FT                   /function="4.6.1 : Plasmid-related functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85243"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IF30"
FT                   /protein_id="CAI85243.1"
FT                   /translation="MKLLYWLDEWLTLSCDEQQAKLPMSGGDLLGDVYVKYDFIDINKP
FT                   LLFTFSPAGTDVQEQDLHADFAPWGYHLAQKQNVNVIAFQHLGKSNWFRNRNLIFFLEQ
FT                   LSPLLTSFKTRLGYGLSRGGFAVGAFAKLLKLDQVLLFHPVSTKNKSLVPWDDRSSTDI
FT                   AQQYDWEGSYADLDLGNAQGYIIYDPTNRIDRLHAKRYKQLNHLRVFGMGHGTHATYLN
FT                   KFGFYKQVAVDFMRHQQIDIAQFRLQTKTLRFKEDYYKRLNKANKKSAHRLELLSTAHN
FT                   ILIDEKTAHVQEHQASIDIQPLIDVALKHQEQHPDDAIQLLEVAKQLAPNDPLVKHKLK
FT                   ELE"
     MKLLYWLDEW LTLSCDEQQA KLPMSGGDLL GDVYVKYDFI DINKPLLFTF SPAGTDVQEQ        60
     DLHADFAPWG YHLAQKQNVN VIAFQHLGKS NWFRNRNLIF FLEQLSPLLT SFKTRLGYGL       120
     SRGGFAVGAF AKLLKLDQVL LFHPVSTKNK SLVPWDDRSS TDIAQQYDWE GSYADLDLGN       180
     AQGYIIYDPT NRIDRLHAKR YKQLNHLRVF GMGHGTHATY LNKFGFYKQV AVDFMRHQQI       240
     DIAQFRLQTK TLRFKEDYYK RLNKANKKSA HRLELLSTAH NILIDEKTAH VQEHQASIDI       300
     QPLIDVALKH QEQHPDDAIQ LLEVAKQLAP NDPLVKHKLK ELE                         343
//

If you have problems or comments...

PBIL Back to PBIL home page