(data stored in ACNUC7421 zone)

EMBL: CR954246.PE14

CR954246.PE14        Location/Qualifiers
FT   CDS             18379..19020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0014"
FT                   /product="conserved protein of unknown function, putative
FT                   GTP-binding domain"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85128"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ20"
FT                   /protein_id="CAI85128.1"
FT                   /translation="MVYNLVHQRMSEYKYPAADVFHQEEIKKSTFIVHIAHTPDLSSAK
FT                   AFIKSIETKYADARHNCWAHVAGKPGGSHVYGFSDDGEPNGTAGKPMLNVLMGSGLGEV
FT                   TAVVTRYFGGIKLGTGGLVRAYGGTLNNALANLSTINKVPSIELIGSSEYSMQGVIEQL
FT                   LKTKYQVLNIDKQFTANIEWVITIDSRQATQAIKDIFDLSHGAVELTIKE"
     MVYNLVHQRM SEYKYPAADV FHQEEIKKST FIVHIAHTPD LSSAKAFIKS IETKYADARH        60
     NCWAHVAGKP GGSHVYGFSD DGEPNGTAGK PMLNVLMGSG LGEVTAVVTR YFGGIKLGTG       120
     GLVRAYGGTL NNALANLSTI NKVPSIELIG SSEYSMQGVI EQLLKTKYQV LNIDKQFTAN       180
     IEWVITIDSR QATQAIKDIF DLSHGAVELT IKE                                    213
//

If you have problems or comments...

PBIL Back to PBIL home page