(data stored in ACNUC7421 zone)

EMBL: CR954246.PE147

CR954246.PE147       Location/Qualifiers
FT   CDS             166112..166615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0157"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85261"
FT                   /db_xref="GOA:Q3IFL9"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL9"
FT                   /protein_id="CAI85261.1"
FT                   /translation="MKYFTYLAVSVMIIAVISLFYLKKPNGETWLSTSVVINESQQIKD
FT                   KIISFTSNTFEQAVSSVSNTPSTTRSKIFKWQDRQGQWHFSDTPHPNGKSVEVKLDPKD
FT                   INVVVAQDTAILSGSSKSSAVNSTSATPTVYDPVSIKKVFDDAEKAKQKLEQRTKQLND
FT                   LNGF"
     MKYFTYLAVS VMIIAVISLF YLKKPNGETW LSTSVVINES QQIKDKIISF TSNTFEQAVS        60
     SVSNTPSTTR SKIFKWQDRQ GQWHFSDTPH PNGKSVEVKL DPKDINVVVA QDTAILSGSS       120
     KSSAVNSTSA TPTVYDPVSI KKVFDDAEKA KQKLEQRTKQ LNDLNGF                     167
//

If you have problems or comments...

PBIL Back to PBIL home page