(data stored in ACNUC7421 zone)

EMBL: CR954246.PE151

CR954246.PE151       Location/Qualifiers
FT   CDS             complement(170509..170892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0161"
FT                   /product="conserved protein of unknown function, similar to
FT                   putative regulator YbcJ from E. coli K12, could bind
FT                   nucleic acids"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85265"
FT                   /db_xref="GOA:Q3IFL5"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL5"
FT                   /protein_id="CAI85265.1"
FT                   /translation="MNEEYIEIELEEEPIELCKLLKVLNLVEGGGQAKNLIAEGYVGVN
FT                   HEICTIKRKKLYSGDILEFDGELFQLALTEDATPVERPAEQPQSEPSQAAPQPASQPAK
FT                   NKRKRTKKPKVDEKTGRRPISFG"
     MNEEYIEIEL EEEPIELCKL LKVLNLVEGG GQAKNLIAEG YVGVNHEICT IKRKKLYSGD        60
     ILEFDGELFQ LALTEDATPV ERPAEQPQSE PSQAAPQPAS QPAKNKRKRT KKPKVDEKTG       120
     RRPISFG                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page