(data stored in ACNUC7421 zone)

EMBL: CR954246.PE152

CR954246.PE152       Location/Qualifiers
FT   CDS             complement(170972..171430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0162"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85266"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL4"
FT                   /protein_id="CAI85266.1"
FT                   /translation="MKLIENIPLFKQMEIINRLGFFKEFSLNERQILLESFGLLYLVRE
FT                   NSFLFKQHDNDKRLFIVLSGALIVFKHNHLLELGTIRPGEFIGEGAFINNRARSISARA
FT                   KTDAIVLAITSDALTRLPNVIREKIKDRIIEGMSLRIAKLSEHIENHG"
     MKLIENIPLF KQMEIINRLG FFKEFSLNER QILLESFGLL YLVRENSFLF KQHDNDKRLF        60
     IVLSGALIVF KHNHLLELGT IRPGEFIGEG AFINNRARSI SARAKTDAIV LAITSDALTR       120
     LPNVIREKIK DRIIEGMSLR IAKLSEHIEN HG                                     152
//

If you have problems or comments...

PBIL Back to PBIL home page