(data stored in ACNUC7421 zone)

EMBL: CR954246.PE155

CR954246.PE155       Location/Qualifiers
FT   CDS             complement(174025..174570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0165"
FT                   /product="conserved protein of unknown function ; putative
FT                   secreted protein"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85269"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFL1"
FT                   /protein_id="CAI85269.1"
FT                   /translation="MLKMQGCRVSSKILLLLITSLLSVCSYAGEKKIYAWKDKNGVLVF
FT                   SDTPHIGAKEIKLTSQDLTMPATNTDILNNQTKAQPVAFSIGIASPEHQQTIRENTGSV
FT                   YVSTRITPRFENDFTIQLLLDGKAYGAASDTSTFALRDVERGEHTLQVKLYNKQNQVIA
FT                   TSPLSVFFMHRKGLSLGN"
     MLKMQGCRVS SKILLLLITS LLSVCSYAGE KKIYAWKDKN GVLVFSDTPH IGAKEIKLTS        60
     QDLTMPATNT DILNNQTKAQ PVAFSIGIAS PEHQQTIREN TGSVYVSTRI TPRFENDFTI       120
     QLLLDGKAYG AASDTSTFAL RDVERGEHTL QVKLYNKQNQ VIATSPLSVF FMHRKGLSLG       180
     N                                                                       181
//

If you have problems or comments...

PBIL Back to PBIL home page