(data stored in ACNUC7421 zone)

EMBL: CR954246.PE158

CR954246.PE158       Location/Qualifiers
FT   CDS             complement(178735..179814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0169"
FT                   /product="putative hydrolase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85272"
FT                   /db_xref="GOA:Q3IFK8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFK8"
FT                   /protein_id="CAI85272.1"
FT                   /translation="MKHITLIIFISCFLSACSTPNQVQKIADKNSVIAVNNQTGRYHNL
FT                   YQGKKVYPTTCEQNCYPPHPNLICETPSSNCQYQGKQIKPPLNTGYTVRWLGHASFVVS
FT                   TRNGQNVLFDPVSEQFDSPVDLGFKLAGGFYRKPGAWPNKQTLENINAVMYSHIHYDHF
FT                   NKADIKKLGNQPRYLAPLGMADNFPTGGFNITEMAWYAKTSIEDLTIHAVPAHHFSNRV
FT                   LIPYIYEDDNKDSWNGWLLEQNGSTLFFAGDTGYSKHFKDIQQKYGDIDLCLMPIASYY
FT                   HKTNAKGYRYVHTTPEDALNAATELNCKVMIPWGYGNSSWQMGDHSSHSALSRLLHMYK
FT                   QMNAPVPLYILNEGETIKL"
     MKHITLIIFI SCFLSACSTP NQVQKIADKN SVIAVNNQTG RYHNLYQGKK VYPTTCEQNC        60
     YPPHPNLICE TPSSNCQYQG KQIKPPLNTG YTVRWLGHAS FVVSTRNGQN VLFDPVSEQF       120
     DSPVDLGFKL AGGFYRKPGA WPNKQTLENI NAVMYSHIHY DHFNKADIKK LGNQPRYLAP       180
     LGMADNFPTG GFNITEMAWY AKTSIEDLTI HAVPAHHFSN RVLIPYIYED DNKDSWNGWL       240
     LEQNGSTLFF AGDTGYSKHF KDIQQKYGDI DLCLMPIASY YHKTNAKGYR YVHTTPEDAL       300
     NAATELNCKV MIPWGYGNSS WQMGDHSSHS ALSRLLHMYK QMNAPVPLYI LNEGETIKL        359
//

If you have problems or comments...

PBIL Back to PBIL home page