(data stored in ACNUC7421 zone)

EMBL: CR954246.PE159

CR954246.PE159       Location/Qualifiers
FT   CDS             complement(179907..180563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0170"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85273"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ36"
FT                   /protein_id="CAI85273.1"
FT                   /translation="MKKQTLLSVTVLALVLTLSGCQSAYYSAMEKVGVHKRDILIDRVE
FT                   ETKDSQQESQEEFKSALERLTTLIDFNGGELQDTYNQLNDDYESSLNAANEVSTNINKV
FT                   EDVAEALFDEWSDELEQYKSASLKRESSKKLAATKRQFDQLLRSMRSAESKMEPVLTSL
FT                   HDNVLYLKHNLNAQAVSAIKGEFTNLKRDIQLLMNDMNKSIADSNKFIEQMNSAG"
     MKKQTLLSVT VLALVLTLSG CQSAYYSAME KVGVHKRDIL IDRVEETKDS QQESQEEFKS        60
     ALERLTTLID FNGGELQDTY NQLNDDYESS LNAANEVSTN INKVEDVAEA LFDEWSDELE       120
     QYKSASLKRE SSKKLAATKR QFDQLLRSMR SAESKMEPVL TSLHDNVLYL KHNLNAQAVS       180
     AIKGEFTNLK RDIQLLMNDM NKSIADSNKF IEQMNSAG                               218
//

If you have problems or comments...

PBIL Back to PBIL home page