(data stored in ACNUC7421 zone)

EMBL: CR954246.PE16

CR954246.PE16        Location/Qualifiers
FT   CDS             20561..21232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0016"
FT                   /product="putative orphan protein"
FT                   /function="6 : No similarity"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0016"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85130"
FT                   /db_xref="GOA:Q3IDH6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH6"
FT                   /protein_id="CAI85130.1"
FT                   /translation="MPTTNLEKLHQIMSGAMVDLEILTPTASKRVKTEFIGLLENRFII
FT                   LNYPSSKRLPTASDYLHDGVMVVVRALIEGSGGQVIAFRQQIMSVASHPARLLFINYPK
FT                   QVQLFDLRSQTRIPTLLSAKLKLSDDRILDGVIKDISLTGVKFDLKDKTQAENIKGMQC
FT                   SIILDSSNKQVKDFQGEICSVKEHVQGAYCGIKLLASEEEMKSFMGDHFIDPSILQSET
FT                   E"
     MPTTNLEKLH QIMSGAMVDL EILTPTASKR VKTEFIGLLE NRFIILNYPS SKRLPTASDY        60
     LHDGVMVVVR ALIEGSGGQV IAFRQQIMSV ASHPARLLFI NYPKQVQLFD LRSQTRIPTL       120
     LSAKLKLSDD RILDGVIKDI SLTGVKFDLK DKTQAENIKG MQCSIILDSS NKQVKDFQGE       180
     ICSVKEHVQG AYCGIKLLAS EEEMKSFMGD HFIDPSILQS ETE                         223
//

If you have problems or comments...

PBIL Back to PBIL home page