(data stored in ACNUC7421 zone)

EMBL: CR954246.PE162

CR954246.PE162       Location/Qualifiers
FT   CDS             complement(181976..182704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0173"
FT                   /product="conserved protein of unknown function; some
FT                   similarity with spermidine synthase (could be an
FT                   aminopropyltransferase)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0173"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85276"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ41"
FT                   /protein_id="CAI85276.1"
FT                   /translation="MLGNMSEYINPVNGLINSYFIENSHSIGQLLYWHKYGGDHIQVRQ
FT                   HQQLRWLLINDTLQSVVTQQQPSNLLLPHLQCLAQHWHTLSTPKKVLELGLGGGAIRNY
FT                   LLHQYPHAKITSAEINADIISCYKKFFTTQQVPNNNTQRLLCEDAQQVLARARNIDWII
FT                   LDLFSQIDAPRFLFAPAFYQKIHAALNNNGTLFINFLSQHESQLKQLQQVLLNVFGYKV
FT                   SPQKVAGYINHIVVITKQLN"
     MLGNMSEYIN PVNGLINSYF IENSHSIGQL LYWHKYGGDH IQVRQHQQLR WLLINDTLQS        60
     VVTQQQPSNL LLPHLQCLAQ HWHTLSTPKK VLELGLGGGA IRNYLLHQYP HAKITSAEIN       120
     ADIISCYKKF FTTQQVPNNN TQRLLCEDAQ QVLARARNID WIILDLFSQI DAPRFLFAPA       180
     FYQKIHAALN NNGTLFINFL SQHESQLKQL QQVLLNVFGY KVSPQKVAGY INHIVVITKQ       240
     LN                                                                      242
//

If you have problems or comments...

PBIL Back to PBIL home page