(data stored in ACNUC7421 zone)

EMBL: CR954246.PE163

CR954246.PE163       Location/Qualifiers
FT   CDS             182867..183760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0174"
FT                   /product="putative acyltransferase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85277"
FT                   /db_xref="GOA:Q3IJ40"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ40"
FT                   /protein_id="CAI85277.1"
FT                   /translation="MFQVSTPQSSEDWQAYYQLRWEILRAPWGEPRGSEQDDLEQDAEH
FT                   RFIKNKAGKVLGVARLHFNNQQQAQVRYMAVAEESRNQHIGSRLLHDLEKIAWSQDAAE
FT                   LVLFARERALEFYKRHGYETQEKAHLAYGDVQHYKMVKQKPSEPGWFRHPNWTQVLQNT
FT                   WRESIPISDAMGIKVESYTDWQFTTSADLDANLNLHNTMFAGSIYSLATLTGWGATYLA
FT                   LKEAGLEGNIVLADANIKYLKPLSSDPRGCVDIQSCKGKLSELETEGKASYLVPVIIYD
FT                   GDKVVAEFEGQFVVKK"
     MFQVSTPQSS EDWQAYYQLR WEILRAPWGE PRGSEQDDLE QDAEHRFIKN KAGKVLGVAR        60
     LHFNNQQQAQ VRYMAVAEES RNQHIGSRLL HDLEKIAWSQ DAAELVLFAR ERALEFYKRH       120
     GYETQEKAHL AYGDVQHYKM VKQKPSEPGW FRHPNWTQVL QNTWRESIPI SDAMGIKVES       180
     YTDWQFTTSA DLDANLNLHN TMFAGSIYSL ATLTGWGATY LALKEAGLEG NIVLADANIK       240
     YLKPLSSDPR GCVDIQSCKG KLSELETEGK ASYLVPVIIY DGDKVVAEFE GQFVVKK          297
//

If you have problems or comments...

PBIL Back to PBIL home page