(data stored in ACNUC7421 zone)

EMBL: CR954246.PE166

CR954246.PE166       Location/Qualifiers
FT   CDS             complement(185078..186196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0177"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85280"
FT                   /db_xref="GOA:Q3IJ37"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ37"
FT                   /protein_id="CAI85280.1"
FT                   /translation="MIASPISQENIVVGEVANGLPLTIPVYRLKGDGTGPSVYIQANMH
FT                   GAEVQGNAVIFQLLEQLKHLNLKGDITLVPYANPIGCNQKSGEFTLGRFDPITGTNWNR
FT                   MYHYNTDLVTQFAQNHMQYDDAILKSAFKQALIDEVDSKLNGPAYLLNTGKRIALNLQK
FT                   LAHQADIVLDLHTGPISSKHLYCPTYATNSARYFNIEHVLLISSDFDGAMDEANFCPWW
FT                   HLSEALSKQGRELSIPVEAFTVELGSQEKIDLSEALNDANSILSYLNYKAVFVNAPHTP
FT                   ANITRYACHLNDYFAYYAPMGGMVEYIAPLGGHIKAGEPIAKILRMERYLSEQPLQTLS
FT                   LESDAIAILHFASASVNQGTELYKFFTNVFEL"
     MIASPISQEN IVVGEVANGL PLTIPVYRLK GDGTGPSVYI QANMHGAEVQ GNAVIFQLLE        60
     QLKHLNLKGD ITLVPYANPI GCNQKSGEFT LGRFDPITGT NWNRMYHYNT DLVTQFAQNH       120
     MQYDDAILKS AFKQALIDEV DSKLNGPAYL LNTGKRIALN LQKLAHQADI VLDLHTGPIS       180
     SKHLYCPTYA TNSARYFNIE HVLLISSDFD GAMDEANFCP WWHLSEALSK QGRELSIPVE       240
     AFTVELGSQE KIDLSEALND ANSILSYLNY KAVFVNAPHT PANITRYACH LNDYFAYYAP       300
     MGGMVEYIAP LGGHIKAGEP IAKILRMERY LSEQPLQTLS LESDAIAILH FASASVNQGT       360
     ELYKFFTNVF EL                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page