(data stored in ACNUC7421 zone)

EMBL: CR954246.PE17

CR954246.PE17        Location/Qualifiers
FT   CDS             21700..21912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0017"
FT                   /product="putative secreted calmodulin-like protein"
FT                   /function="5.1 : From P. haloplanktis"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85131"
FT                   /db_xref="GOA:Q3IDH5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IDH5"
FT                   /protein_id="CAI85131.1"
FT                   /translation="MKTLNKTLALIALASSSAAFAASDFDALDVDGNGAISQSEAAVDA
FT                   ELMSIFSELDTDQNGELSKEEFSKA"
     MKTLNKTLAL IALASSSAAF AASDFDALDV DGNGAISQSE AAVDAELMSI FSELDTDQNG        60
     ELSKEEFSKA                                                               70
//

If you have problems or comments...

PBIL Back to PBIL home page