(data stored in ACNUC7421 zone)

EMBL: CR954246.PE170

CR954246.PE170       Location/Qualifiers
FT   CDS             189645..190343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0181"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85284"
FT                   /db_xref="GOA:Q3IJ33"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ33"
FT                   /protein_id="CAI85284.1"
FT                   /translation="MEKFNDIYQRAVERKGSTQMLQQLLAKPASKRQLVALSDDDWLEE
FT                   FTRKVFQSGFYWSVINSKWAGFREVFWQFSVEKLLMMPPDMLEQKASDERIVRNYKKVK
FT                   TIPENAFMIHEVTQQHGSFSQFIADWPSEDIIGLWAYLKKHGARLGGNTGPYTLRALGK
FT                   DTFLLSRDVESYLRAHKIIDGGLQTKKSLTAAQAFFNELQQQSGLSMQELSLIIAYSVG
FT                   DNRVGISQQQ"
     MEKFNDIYQR AVERKGSTQM LQQLLAKPAS KRQLVALSDD DWLEEFTRKV FQSGFYWSVI        60
     NSKWAGFREV FWQFSVEKLL MMPPDMLEQK ASDERIVRNY KKVKTIPENA FMIHEVTQQH       120
     GSFSQFIADW PSEDIIGLWA YLKKHGARLG GNTGPYTLRA LGKDTFLLSR DVESYLRAHK       180
     IIDGGLQTKK SLTAAQAFFN ELQQQSGLSM QELSLIIAYS VGDNRVGISQ QQ               232
//

If you have problems or comments...

PBIL Back to PBIL home page