(data stored in ACNUC7421 zone)

EMBL: CR954246.PE171

CR954246.PE171       Location/Qualifiers
FT   CDS             190353..191762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0182"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85285"
FT                   /db_xref="GOA:Q3IJ32"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q3IJ32"
FT                   /protein_id="CAI85285.1"
FT                   /translation="MNLMPRYRQVADNFAIEDRPSKVAAPQLLLWNDSLAKAFNINVVP
FT                   ELRASTFSGNEQQAIAAVALGYSGHQFGHFSPRLGDGRAHLLGAVEDAQNQLWDIQLKG
FT                   SGATPYSRGGDGRCALGPAIREYIMSEAMQALGIKTTRCLAVVGSGETVYRNPPQPGAI
FT                   VTRLASSHIRVGSFQYLATQGDVAGLKNLADLAIERHYPKIQATGPERYLAFLAAVIKN
FT                   QVELVVSWMRVGFIHGVMNTDNTLVSGETIDYGPCAMMNSFDFDTVFSSIDKQGRYAFG
FT                   NQPNIANWNCARLAESLIPLVNDDDEQAVALMTPIIDGFAEQFNVEFSAMWATKLGLAG
FT                   TDTADKELIAELLQLLKEHQLDYTNTFDALTESLTGGMSIPEVLVQWAGKWQKRTDDRS
FT                   YTVMRAANPRVIPRNHVIEKILSEYNKTGSSELLHEFMQVMHTPYENTDKLAKFQDAPS
FT                   SDKEYYTFCGT"
     MNLMPRYRQV ADNFAIEDRP SKVAAPQLLL WNDSLAKAFN INVVPELRAS TFSGNEQQAI        60
     AAVALGYSGH QFGHFSPRLG DGRAHLLGAV EDAQNQLWDI QLKGSGATPY SRGGDGRCAL       120
     GPAIREYIMS EAMQALGIKT TRCLAVVGSG ETVYRNPPQP GAIVTRLASS HIRVGSFQYL       180
     ATQGDVAGLK NLADLAIERH YPKIQATGPE RYLAFLAAVI KNQVELVVSW MRVGFIHGVM       240
     NTDNTLVSGE TIDYGPCAMM NSFDFDTVFS SIDKQGRYAF GNQPNIANWN CARLAESLIP       300
     LVNDDDEQAV ALMTPIIDGF AEQFNVEFSA MWATKLGLAG TDTADKELIA ELLQLLKEHQ       360
     LDYTNTFDAL TESLTGGMSI PEVLVQWAGK WQKRTDDRSY TVMRAANPRV IPRNHVIEKI       420
     LSEYNKTGSS ELLHEFMQVM HTPYENTDKL AKFQDAPSSD KEYYTFCGT                   469
//

If you have problems or comments...

PBIL Back to PBIL home page