(data stored in ACNUC7421 zone)

EMBL: CR954246.PE172

CR954246.PE172       Location/Qualifiers
FT   CDS             192148..193212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0183"
FT                   /product="putative outer membrane protein; signal peptide"
FT                   /function="1.2.6 : Porins"
FT                   /function="1.1.3 : Surface structures (S-layers?)"
FT                   /function="1.9.1 : Biofim formation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 12220987; Product type m : membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85286"
FT                   /db_xref="GOA:Q3IJ31"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IJ31"
FT                   /protein_id="CAI85286.1"
FT                   /translation="MKLKSLTIAIALAATSASAFAAEKTEGFYIGVFGDYYDASWKNLN
FT                   MHQNLEVNESASWGAEVGYRFSDYWSARLEYADMDFNAFLKNPIPNGNRNDVDGERFGV
FT                   DALYHFGGGPFYGLFGIKEVKVATDNTFLNAGVGYQHFITDGLFVNAETSVYQGLDRGY
FT                   TDVNAKLGINYLFGQSSVAEEPVQPAPEPVIVEVAPVDSDNDNIPDADDQCPNTPMTDA
FT                   VDGTGCTLYEDKEVTVSLLVTFPNNTSAVSTQYLNDIDKVAEFLKEYPDTTVLLEGHTS
FT                   SVGKASYNKWLSKKRADAVAKKLVADGVAEDRITTVGLGEERLKNEANTKAAHEENRRV
FT                   EAHIKTIKNVKVLR"
     MKLKSLTIAI ALAATSASAF AAEKTEGFYI GVFGDYYDAS WKNLNMHQNL EVNESASWGA        60
     EVGYRFSDYW SARLEYADMD FNAFLKNPIP NGNRNDVDGE RFGVDALYHF GGGPFYGLFG       120
     IKEVKVATDN TFLNAGVGYQ HFITDGLFVN AETSVYQGLD RGYTDVNAKL GINYLFGQSS       180
     VAEEPVQPAP EPVIVEVAPV DSDNDNIPDA DDQCPNTPMT DAVDGTGCTL YEDKEVTVSL       240
     LVTFPNNTSA VSTQYLNDID KVAEFLKEYP DTTVLLEGHT SSVGKASYNK WLSKKRADAV       300
     AKKLVADGVA EDRITTVGLG EERLKNEANT KAAHEENRRV EAHIKTIKNV KVLR             354
//

If you have problems or comments...

PBIL Back to PBIL home page