(data stored in ACNUC7421 zone)

EMBL: CR954246.PE174

CR954246.PE174       Location/Qualifiers
FT   CDS             196306..196938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0185"
FT                   /product="putative biofilm formation, controlled by quorum
FT                   sensing, formation of cell aggregates"
FT                   /function="4.1 : Adaptation to atypical conditions"
FT                   /function="1.9.1 : Biofim formation"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; PubMedId : 14729694"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85288"
FT                   /db_xref="InterPro:IPR018724"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK57"
FT                   /protein_id="CAI85288.1"
FT                   /translation="MTALNPQNLLQLRFINQTNIDLVKPSFDNLPTNPYADGAFRKRRY
FT                   SVVKLQNGELKLQATKAFVQDDAINTFQGNVERSYENLEQSLLESAGMKSIVNEFRQIT
FT                   GIDEERDIEIHQFRMLAIDSDTPAAPEGVHQDGFDHVCVCGVSHENLEGGELLVYENKQ
FT                   ADPCFKMAIKDGMFAVINDRQVWHNATPMNKLDASKPGYLDCFVLTS"
     MTALNPQNLL QLRFINQTNI DLVKPSFDNL PTNPYADGAF RKRRYSVVKL QNGELKLQAT        60
     KAFVQDDAIN TFQGNVERSY ENLEQSLLES AGMKSIVNEF RQITGIDEER DIEIHQFRML       120
     AIDSDTPAAP EGVHQDGFDH VCVCGVSHEN LEGGELLVYE NKQADPCFKM AIKDGMFAVI       180
     NDRQVWHNAT PMNKLDASKP GYLDCFVLTS                                        210
//

If you have problems or comments...

PBIL Back to PBIL home page