(data stored in ACNUC7421 zone)

EMBL: CR954246.PE176

CR954246.PE176       Location/Qualifiers
FT   CDS             complement(198203..198907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0187"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85290"
FT                   /db_xref="GOA:Q3IK62"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK62"
FT                   /protein_id="CAI85290.1"
FT                   /translation="MTDFIRVYDNALSNDFCDNFITTFSQSPHIKQGMTSGGIDLNKKD
FT                   SHDLHLNNHPEYVEQLKHIQQTTAQYVFKYIEEHIFIMIGAFGLKVYHPKSGEPVDLTH
FT                   ANFDEVGKPQLPLLVQQIFRLGNIQAQKYQVNKGGYPYWHSEVYPQLNHNEALHRVLLF
FT                   MFYLNDVEQGGETEFYYQKRKIAPKKGTMVIAPGYFTHTHRGNKPVSNDKYILTSWVLF
FT                   NRAEQIYGAPKS"
     MTDFIRVYDN ALSNDFCDNF ITTFSQSPHI KQGMTSGGID LNKKDSHDLH LNNHPEYVEQ        60
     LKHIQQTTAQ YVFKYIEEHI FIMIGAFGLK VYHPKSGEPV DLTHANFDEV GKPQLPLLVQ       120
     QIFRLGNIQA QKYQVNKGGY PYWHSEVYPQ LNHNEALHRV LLFMFYLNDV EQGGETEFYY       180
     QKRKIAPKKG TMVIAPGYFT HTHRGNKPVS NDKYILTSWV LFNRAEQIYG APKS             234
//

If you have problems or comments...

PBIL Back to PBIL home page