(data stored in ACNUC7421 zone)

EMBL: CR954246.PE177

CR954246.PE177       Location/Qualifiers
FT   CDS             198941..199339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0188"
FT                   /product="conserved protein of unknown function (could be a
FT                   thioesterase)"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85291"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK61"
FT                   /protein_id="CAI85291.1"
FT                   /translation="MFIEKVMPRFSETDALGHINNTVLPVWFEASRAPIFRFFTPDLNP
FT                   HDWKLIIAKVEVSFVGELFYGHEVTIKTSVEHVGTSSFVLRQEAHQQGNCCAVGKTVLV
FT                   RYDFAAKAKQSLSVSEKSSLNEHLAPAS"
     MFIEKVMPRF SETDALGHIN NTVLPVWFEA SRAPIFRFFT PDLNPHDWKL IIAKVEVSFV        60
     GELFYGHEVT IKTSVEHVGT SSFVLRQEAH QQGNCCAVGK TVLVRYDFAA KAKQSLSVSE       120
     KSSLNEHLAP AS                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page