(data stored in ACNUC7421 zone)

EMBL: CR954246.PE180

CR954246.PE180       Location/Qualifiers
FT   CDS             complement(202624..202866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0191"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85294"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IK58"
FT                   /protein_id="CAI85294.1"
FT                   /translation="MLGEDHSLTQDFPEHLNTIKKLNSNDPEFADKAKKYNALDKEIRT
FT                   LELQDAPIDDEEMLQLKHDRVVLKDWLHQQLLKAS"
     MLGEDHSLTQ DFPEHLNTIK KLNSNDPEFA DKAKKYNALD KEIRTLELQD APIDDEEMLQ        60
     LKHDRVVLKD WLHQQLLKAS                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page