(data stored in ACNUC7421 zone)

EMBL: CR954246.PE182

CR954246.PE182       Location/Qualifiers
FT   CDS             203765..204925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0193"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85296"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFU0"
FT                   /protein_id="CAI85296.1"
FT                   /translation="MTEIVQQPRIVKMLNQRAHDLLLGHNFAHQQIGFIHTLEMDYGEP
FT                   LKQRTLLEVEVAAQQKRKLKSTAHHKYRAAASEQLHKAIEKMMSEQLSDIDSVIQNTIG
FT                   VEDSVCAMLDILATKSASVGRLEPLVNDLSWLGRELVTLVNLPYYRNQRSKNTAVKVDS
FT                   PALALRYIGLDNLQLVVPTFAVRHWMPYSTEPFSLLKRRLKESAMANAIAAQKIAEVNE
FT                   VNPSHAFTLGMLLNVGQIALVRLYLKVFEQIWQRKVQFARTTANKGLHTALLELKPDPL
FT                   FLTTLLSEQSLAISAKIIEKMAFKYLPFNSVMQQLVNGVEKGDTALPLTQVMLKARCYS
FT                   QYLTLKQHQLVEPDETLSWFSYFKFTKKELKALQASNFNNLAIQID"
     MTEIVQQPRI VKMLNQRAHD LLLGHNFAHQ QIGFIHTLEM DYGEPLKQRT LLEVEVAAQQ        60
     KRKLKSTAHH KYRAAASEQL HKAIEKMMSE QLSDIDSVIQ NTIGVEDSVC AMLDILATKS       120
     ASVGRLEPLV NDLSWLGREL VTLVNLPYYR NQRSKNTAVK VDSPALALRY IGLDNLQLVV       180
     PTFAVRHWMP YSTEPFSLLK RRLKESAMAN AIAAQKIAEV NEVNPSHAFT LGMLLNVGQI       240
     ALVRLYLKVF EQIWQRKVQF ARTTANKGLH TALLELKPDP LFLTTLLSEQ SLAISAKIIE       300
     KMAFKYLPFN SVMQQLVNGV EKGDTALPLT QVMLKARCYS QYLTLKQHQL VEPDETLSWF       360
     SYFKFTKKEL KALQASNFNN LAIQID                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page