(data stored in ACNUC7421 zone)

EMBL: CR954246.PE186

CR954246.PE186       Location/Qualifiers
FT   CDS             209218..209556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0197"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85300"
FT                   /db_xref="InterPro:IPR020979"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT6"
FT                   /protein_id="CAI85300.1"
FT                   /translation="MVLNRQGYDDLIMYLTQNLALFEKPGEIKPGAPTVMELIEDVIAQ
FT                   NVMLICQQHTELTTEQRSQIVREVDGIVYDLQEVLSSITSRPVTVEQHMFIDEFGGLVK
FT                   NLFDNAVS"
     MVLNRQGYDD LIMYLTQNLA LFEKPGEIKP GAPTVMELIE DVIAQNVMLI CQQHTELTTE        60
     QRSQIVREVD GIVYDLQEVL SSITSRPVTV EQHMFIDEFG GLVKNLFDNA VS               112
//

If you have problems or comments...

PBIL Back to PBIL home page