(data stored in ACNUC7421 zone)

EMBL: CR954246.PE187

CR954246.PE187       Location/Qualifiers
FT   CDS             209726..210139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0198"
FT                   /product="conserved protein of unknown function"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85301"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT5"
FT                   /protein_id="CAI85301.1"
FT                   /translation="MQANVKWVEGNTFIGRSNSNHNVVFDGGSDSAAPSPMEMVLMSIG
FT                   CCSSVDVVSILKKAKQDFSNVEVQLTAERAETAPRVFTKVNLHFVATGNNVSEKHLARA
FT                   VSLSAEKYCSVALMLDKTVKITHSHEVVQDQVK"
     MQANVKWVEG NTFIGRSNSN HNVVFDGGSD SAAPSPMEMV LMSIGCCSSV DVVSILKKAK        60
     QDFSNVEVQL TAERAETAPR VFTKVNLHFV ATGNNVSEKH LARAVSLSAE KYCSVALMLD       120
     KTVKITHSHE VVQDQVK                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page