(data stored in ACNUC7421 zone)

EMBL: CR954246.PE191

CR954246.PE191       Location/Qualifiers
FT   CDS             212751..213221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0202"
FT                   /product="putative ribosome protein acetyltransferase"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolgy; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85305"
FT                   /db_xref="GOA:Q3IFT1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT1"
FT                   /protein_id="CAI85305.1"
FT                   /translation="MLLQFESENKAWFESMLPPREDYFYRDLGIKMHIYDAIINMQLGT
FT                   HYSGVLIVNEQIVARANLKDITGQTNTAAVGYRVAKNSIGKGYASFCLNELISIAAQHY
FT                   AVNKLEALVLDNNPASKAVLLKCGFKAQSHKDNYMTINGHTLGVTHFLRAPI"
     MLLQFESENK AWFESMLPPR EDYFYRDLGI KMHIYDAIIN MQLGTHYSGV LIVNEQIVAR        60
     ANLKDITGQT NTAAVGYRVA KNSIGKGYAS FCLNELISIA AQHYAVNKLE ALVLDNNPAS       120
     KAVLLKCGFK AQSHKDNYMT INGHTLGVTH FLRAPI                                 156
//

If you have problems or comments...

PBIL Back to PBIL home page