(data stored in ACNUC7421 zone)

EMBL: CR954246.PE192

CR954246.PE192       Location/Qualifiers
FT   CDS             complement(213286..213525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0203"
FT                   /product="putative orphan protein"
FT                   /function="6.2 : Hypothetical"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85306"
FT                   /db_xref="UniProtKB/TrEMBL:Q3IFT0"
FT                   /protein_id="CAI85306.1"
FT                   /translation="MLKNIVIVAAVIAHNKRESQRIAGIRRVLGCDNSISLSISYFASV
FT                   HQIIKSPNADKLKCRNIICETQNATQTRGSYSLT"
     MLKNIVIVAA VIAHNKRESQ RIAGIRRVLG CDNSISLSIS YFASVHQIIK SPNADKLKCR        60
     NIICETQNAT QTRGSYSLT                                                     79
//

If you have problems or comments...

PBIL Back to PBIL home page