(data stored in ACNUC7421 zone)

EMBL: CR954246.PE196

CR954246.PE196       Location/Qualifiers
FT   CDS             214195..215598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="PSHAa0207"
FT                   /product="conserved protein of unknown function"
FT                   /function="5 : Similar to unknown proteins"
FT                   /function="5.2 : From other organisms"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:PSHAa0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAI85310"
FT                   /db_xref="InterPro:IPR011646"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q3ILR6"
FT                   /protein_id="CAI85310.1"
FT                   /translation="MEFKSNKIIIDPNDPFKNDKLGRKPHVENFTTLLKNISSPIVLSV
FT                   NAPWGQGKTTFLEMLEGNLQINNCSAIYFSAWETDFVNDPLQAFLGEVNKKIESLVEGD
FT                   KEKSKAWVKAKSAGAQILKKGLPVLVKLATAGIIDAGKITEAEAAKFTEGLSKDFLDDY
FT                   TKSKEAITSFKENVSKALKNEDGGASQLFIIIDELDRCRPTYAIELLERIKHLLDIEGL
FT                   VFVIAMDKLQLSHSVKGVYGAGFEAMGYLRRFIDIEYILPESDLDAFIEQLYKVFEFDI
FT                   FFQKRTQYQAFRYEKDYLKNTFKLLAKAKKLSLREVEQLFAKVNLVVKSTAENVYLYPD
FT                   LLAFLIVAKEYYYESYSGYINGGDTPEKLIQVLHSITPSLKSIDSRACAVIESSLIGAK
FT                   NDEYQGNIGGALKYHEDMSSDESASTDEQNYSHDVVQITKSFDGFRNSIDLESLKQRIE
FT                   MLESFKFNS"
     MEFKSNKIII DPNDPFKNDK LGRKPHVENF TTLLKNISSP IVLSVNAPWG QGKTTFLEML        60
     EGNLQINNCS AIYFSAWETD FVNDPLQAFL GEVNKKIESL VEGDKEKSKA WVKAKSAGAQ       120
     ILKKGLPVLV KLATAGIIDA GKITEAEAAK FTEGLSKDFL DDYTKSKEAI TSFKENVSKA       180
     LKNEDGGASQ LFIIIDELDR CRPTYAIELL ERIKHLLDIE GLVFVIAMDK LQLSHSVKGV       240
     YGAGFEAMGY LRRFIDIEYI LPESDLDAFI EQLYKVFEFD IFFQKRTQYQ AFRYEKDYLK       300
     NTFKLLAKAK KLSLREVEQL FAKVNLVVKS TAENVYLYPD LLAFLIVAKE YYYESYSGYI       360
     NGGDTPEKLI QVLHSITPSL KSIDSRACAV IESSLIGAKN DEYQGNIGGA LKYHEDMSSD       420
     ESASTDEQNY SHDVVQITKS FDGFRNSIDL ESLKQRIEML ESFKFNS                     467
//

If you have problems or comments...

PBIL Back to PBIL home page